General Information

  • ID:  hor004579
  • Uniprot ID:  Q95274
  • Protein name:  Hematopoietic system regulatory peptide
  • Gene name:  TMSB4
  • Organism:  Sus scrofa (Pig)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKP
  • Length:  4(2-5)
  • Propeptide:  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T1 Phosphoserine;T3 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the entry of hematopoietic pluripotent stem cells into the S-phase
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  ACTG1
  • Target Unid:  I3LVD5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 80 minutes; /4800 seconds ( PubMed ID: 8257427 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95274-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004579_AF2.pdbhor004579_ESM.pdb

Physical Information

Mass: 49916 Formula: C18H31N5O8
Absent amino acids: ACEFGHILMNQRTVWY Common amino acids: DKPS
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 0
Hydrophobicity: -245 Boman Index: -1767
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -3257.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8257427
  • Title:  NA